Result
| Job ID | 202503151345078 |
| RCSB PDB ID | CD3Eecd |
| CHAIN ID | A |
| JNN |
Confidence Level |
Patch Level (ALL) |
|||||||||||||||||||||||||||||||||||||||
Confidence of predictions
|
| |||||||||||||||||||||||||||||||||||||||
| Download | Download |
| No. Patch | Score | Show Patch | |
| 1 | 17.8053 | Show residue Patch 1 | |
| 2 | 5.5308 | Show residue Patch 2 | |
| All | Show All atom Patchs | ||
| Download PatchInfo | |||
Extra information
Sequence View (Color by confidence) [ Detail ]
chain:AQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENC
Residue based prediction
chain:AQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENC
Density map quality check
Box plots of patchsumSequence similarity to training set
Blast result of chain AMulti-View
This page allows you to view all predicted binding sites simultaneously.[ link ]